Structure of PDB 3a58 Chain B

Receptor sequence
>3a58B (length=178) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
SIRRKLVIVGDGACGKTCLLIVNSKGQFPEVYVPTVFENYVADVEVDGRR
VELALWDTAGQEDYDRLRPLSYPDSNVVLICFSIDLPDSLENVQEKWIAE
VLHFCQGVPIILVGCKVDLRNDPQTIEQLRQEGQQPVTSQEGQSVADQIG
ATGYYECSAKTGYGVREVFEAATRASLM
3D structure
PDB3a58 Structural basis for the Rho- and phosphoinositide-dependent localization of the exocyst subunit Sec3
ChainB
Resolution2.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.6.5.2: small monomeric GTPase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 GNP B A20 G22 K23 T24 C25 F35 E37 Y39 T42 G67 K123 D125 S165 K167 A13 G15 K16 T17 C18 F28 E30 Y32 T35 G60 K116 D118 S158 K160
BS02 MG B T24 T42 T17 T35
Gene Ontology
Molecular Function
GO:0003924 GTPase activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0008047 enzyme activator activity
GO:0016787 hydrolase activity
GO:0019901 protein kinase binding
GO:0031681 G-protein beta-subunit binding
Biological Process
GO:0006075 (1->3)-beta-D-glucan biosynthetic process
GO:0007015 actin filament organization
GO:0007117 budding cell bud growth
GO:0007165 signal transduction
GO:0007264 small GTPase-mediated signal transduction
GO:0008361 regulation of cell size
GO:0009272 fungal-type cell wall biogenesis
GO:0030036 actin cytoskeleton organization
GO:0030476 ascospore wall assembly
GO:0032186 cellular bud neck septin ring organization
GO:0032880 regulation of protein localization
GO:0032889 regulation of vacuole fusion, non-autophagic
GO:0032956 regulation of actin cytoskeleton organization
GO:0045807 positive regulation of endocytosis
GO:0060178 regulation of exocyst localization
GO:0060237 regulation of fungal-type cell wall organization
GO:0090037 positive regulation of protein kinase C signaling
GO:0090334 regulation of cell wall (1->3)-beta-D-glucan biosynthetic process
GO:1903395 regulation of secondary cell septum biogenesis
GO:1903501 positive regulation of mitotic actomyosin contractile ring assembly
Cellular Component
GO:0000131 incipient cellular bud site
GO:0000148 1,3-beta-D-glucan synthase complex
GO:0000329 fungal-type vacuole membrane
GO:0005739 mitochondrion
GO:0005741 mitochondrial outer membrane
GO:0005768 endosome
GO:0005777 peroxisome
GO:0005778 peroxisomal membrane
GO:0005783 endoplasmic reticulum
GO:0005794 Golgi apparatus
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0005933 cellular bud
GO:0005934 cellular bud tip
GO:0005935 cellular bud neck
GO:0009277 fungal-type cell wall
GO:0010008 endosome membrane
GO:0016020 membrane
GO:0031160 spore wall
GO:0043332 mating projection tip
GO:0071944 cell periphery

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3a58, PDBe:3a58, PDBj:3a58
PDBsum3a58
PubMed20062059
UniProtP06780|RHO1_YEAST GTP-binding protein RHO1 (Gene Name=RHO1)

[Back to BioLiP]