Structure of PDB 3a3p Chain B |
>3a3pB (length=65) Species: 311400 (Thermococcus kodakarensis) [Search protein sequence] |
TIRVIVSVDKAKFNPHEVLGIGGHIVYQFKLIPAVVVDVPANAVGKLKKM PGVEKVEFDHQAVLL |
|
PDB | 3a3p Identification of the interactions critical for propeptide-catalyzed folding of Tk-subtilisin |
Chain | B |
Resolution | 1.9 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
B |
H28 D42 |
H24 D38 |
|
|
|