Structure of PDB 2zz6 Chain B

Receptor sequence

>2zz6B (length=215) Species: 145262 (Methanothermobacter thermautotrophicus)

VMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFR
KRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACL
NVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTR
PERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADN
PAAAAAGIIESIKDL

3D structure

• PDB: 2zz6 Structural characterization of the molecular events during a slow substrate-product transition in orotidine 5'-monophosphate decarboxylase
• Chain: B
• Resolution: 1.66 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): K42 D70 K72 D75
• Catalytic site (residue number reindexed from 1): K32 D60 K62 D65
• Enzyme Commision number: 4.1.1.23: orotidine-5'-phosphate decarboxylase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	6AZ	B	D75 I76 T79	D65 I66 T69	PDBbind-CN: -logKd/Ki=6.72,Ki=0.19uM BindingDB: Ki=190nM
BS02	6AZ	B	D20 K72 M126 S127 P180 Q185 G202 R203	D10 K62 M116 S117 P170 Q175 G192 R193	PDBbind-CN: -logKd/Ki=6.72,Ki=0.19uM BindingDB: Ki=190nM

Gene Ontology

Molecular Function

• GO:0004590 orotidine-5'-phosphate decarboxylase activity
• GO:0016831 carboxy-lyase activity

Biological Process

• GO:0006207 'de novo' pyrimidine nucleobase biosynthetic process
• GO:0006221 pyrimidine nucleotide biosynthetic process
• GO:0044205 'de novo' UMP biosynthetic process

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:2zz6, PDBe:2zz6, PDBj:2zz6
• PDBsum: 2zz6
• PubMed: 19236876
• UniProt: O26232|PYRF_METTH Orotidine 5'-phosphate decarboxylase (Gene Name=pyrF)