Structure of PDB 2zwg Chain B

Receptor sequence

>2zwgB (length=72) Species: 79261 (Streptomyces castaneoglobisporus)

AAPESFDEVYKGRRIQGRPAGYEVFVDGVQLHVMRNADGSWISVVSHFDP
VPTPRAAARAAVDELQGAPLLP

3D structure

• PDB: 2zwg Crystallographic evidence that the dinuclear copper center of tyrosinase is flexible during catalysis
• Chain: B
• Resolution: 1.32 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CU	B	H82 M84 H97	H32 M34 H47

Gene Ontology

Molecular Function

• GO:0005507 copper ion binding

Biological Process

• GO:0042438 melanin biosynthetic process

External links

• PDB: RCSB:2zwg, PDBe:2zwg, PDBj:2zwg
• PDBsum: 2zwg
• UniProt: Q83WS1