Structure of PDB 2zwe Chain B

Receptor sequence

>2zweB (length=78) Species: 79261 (Streptomyces castaneoglobisporus)

AAPESFDEVYKGRRIQGRPAHEHGGGYEVFVDGVQLHVMRNADGSWISVV
SHFDPVPTPRAAARAAVDELQGAPLLPF

3D structure

• PDB: 2zwe Crystallographic evidence that the dinuclear copper center of tyrosinase is flexible during catalysis
• Chain: B
• Resolution: 1.32 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CU	B	H82 M84 H97	H37 M39 H52

Gene Ontology

Molecular Function

• GO:0005507 copper ion binding

Biological Process

• GO:0042438 melanin biosynthetic process

External links

• PDB: RCSB:2zwe, PDBe:2zwe, PDBj:2zwe
• PDBsum: 2zwe
• UniProt: Q83WS1