Structure of PDB 2zup Chain B

Receptor sequence
>2zupB (length=145) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
AWLLMAFTALALELTALWFQHVMLLKPCVLCIYERVALFGVLGAALIGAI
APKTPLRYVAMVIWLYSAFRGVQLTYEHTMLQLYPSPFATCDFMVRFPEW
LPLDKWVPQVFVASGDSWDFLGLEMPQWLLGIFIAYLIVAVLVVI
3D structure
PDB2zup Dynamic nature of disulphide bond formation catalysts revealed by crystal structures of DsbB
ChainB
Resolution3.7 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) C41 C44 R48 C104 S130
Catalytic site (residue number reindexed from 1) C28 C31 R35 C91 S117
Enzyme Commision number 1.8.5.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 UQ1 B A29 Q33 K39 C44 E47 R48 M142 L146 A16 Q20 K26 C31 E34 R35 M125 L129
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0009055 electron transfer activity
GO:0015035 protein-disulfide reductase activity
GO:0016491 oxidoreductase activity
GO:0016672 oxidoreductase activity, acting on a sulfur group of donors, quinone or similar compound as acceptor
GO:0048039 ubiquinone binding
Biological Process
GO:0006457 protein folding
GO:0009408 response to heat
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2zup, PDBe:2zup, PDBj:2zup
PDBsum2zup
PubMed19214188
UniProtP0A6M2|DSBB_ECOLI Disulfide bond formation protein B (Gene Name=dsbB)

[Back to BioLiP]