Structure of PDB 2zs1 Chain B

Receptor sequence

>2zs1B (length=142) Species: 55676 (Oligobrachia mashikoi)

DCTSLNRLLVKRQWAEAYGEGTNRELLGNRIWEDLFANMPDARGLFSRVN
GNDIDSSEFQAHSLRVLGGLDMCVASLDDVPVLNALLARLNSQHDSRGIP
AAGYPAFVASAISAVRATVGARSFDNDAWNSCMNQIVSGISG

3D structure

• PDB: 2zs1 Structural Basis for the Heterotropic and Homotropic Interactions of Invertebrate Giant Hemoglobin
• Chain: B
• Resolution: 1.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	B	L45 F46 R48 V49 H62 V66 H94 I99 G103 Y104 F107	L45 F46 R48 V49 H62 V66 H94 I99 G103 Y104 F107
BS02	OXY	B	H62 V66	H62 V66
BS03	MG	B	D55 S56	D55 S56

Gene Ontology

Molecular Function

• GO:0005344 oxygen carrier activity
• GO:0005506 iron ion binding
• GO:0019825 oxygen binding
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0015671 oxygen transport

Cellular Component

• GO:0005576 extracellular region
• GO:0005833 hemoglobin complex

External links

• PDB: RCSB:2zs1, PDBe:2zs1, PDBj:2zs1
• PDBsum: 2zs1
• PubMed: 18834142
• UniProt: Q7M413|GLBA2_OLIMA Extracellular giant hemoglobin major globin subunit A2 (Gene Name=ghbA2)