Structure of PDB 2zmy Chain B

Receptor sequence

>2zmyB (length=78) Species: 79261 (Streptomyces castaneoglobisporus)

AAPESFDEVYKGRRIQGRPAHEHGGGYEVFVDGVQLHVMRNADGSWISVV
SHYDPVPTPRAAARAAVDELQGAPLLPF

3D structure

• PDB: 2zmy Crystallographic Evidence That the Dinuclear Copper Center of Tyrosinase Is Flexible during Catalysis
• Chain: B
• Resolution: 1.45 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CU	B	E67 H68 H82	E22 H23 H37

Gene Ontology

Molecular Function

• GO:0005507 copper ion binding

Biological Process

• GO:0042438 melanin biosynthetic process

External links

• PDB: RCSB:2zmy, PDBe:2zmy, PDBj:2zmy
• PDBsum: 2zmy
• UniProt: Q83WS1