Structure of PDB 2zmx Chain B

Receptor sequence

>2zmxB (length=77) Species: 79261 (Streptomyces castaneoglobisporus)

AAPESFDEVYKGRRIQGRPAHEHGGGYEVFVDGVQLHVMRNADGSWISVV
SHYDPVPTPRAAARAAVDELQGAPLLP

3D structure

• PDB: 2zmx Crystallographic Evidence That the Dinuclear Copper Center of Tyrosinase Is Flexible during Catalysis
• Chain: B
• Resolution: 1.33 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CU	B	E67 H68 H82	E22 H23 H37

Gene Ontology

Molecular Function

• GO:0005507 copper ion binding

Biological Process

• GO:0042438 melanin biosynthetic process

External links

• PDB: RCSB:2zmx, PDBe:2zmx, PDBj:2zmx
• PDBsum: 2zmx
• PubMed: 16436386
• UniProt: Q83WS1