Structure of PDB 2zlw Chain B

Receptor sequence

>2zlwB (length=146) Species: 9796 (Equus caballus)

VQLSGEEKAAVLALWDKVNEEEVGGEALGRLLVVYPWTQRFFDSFGDLSN
PGAVMGNPKVKAHGKKVLHSFGEGVHHLDNLKGTFAALSELHCDKLHVDP
ENFRLLGNVLVVVLARHFGKDFTPELQASYQKVVAGVANALAHKYH

3D structure

• PDB: 2zlw Water-mediated variability in the structure of relaxed-state haemoglobin
• Chain: B
• Resolution: 2.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	B	F41 F42 H63 F71 H92 L96 V98 N102 L106 L141	F41 F42 H63 F71 H92 L96 V98 N102 L106 L141

Gene Ontology

Molecular Function

• GO:0004601 peroxidase activity
• GO:0005344 oxygen carrier activity
• GO:0019825 oxygen binding
• GO:0020037 heme binding
• GO:0031720 haptoglobin binding
• GO:0031721 hemoglobin alpha binding
• GO:0043177 organic acid binding
• GO:0046872 metal ion binding

Biological Process

• GO:0015671 oxygen transport
• GO:0042744 hydrogen peroxide catabolic process
• GO:0098869 cellular oxidant detoxification

Cellular Component

• GO:0005833 hemoglobin complex
• GO:0031838 haptoglobin-hemoglobin complex

External links

• PDB: RCSB:2zlw, PDBe:2zlw, PDBj:2zlw
• PDBsum: 2zlw
• PubMed: 18540052
• UniProt: P02062|HBB_HORSE Hemoglobin subunit beta (Gene Name=HBB)