Structure of PDB 2zev Chain B

Receptor sequence

>2zevB (length=299) Species: 4932 (Saccharomyces cerevisiae)

KMEAKIDELINNDPVWSSQNESLISKPYNHILLKNFRLNLIVQINRVMNL
PKDQLAIVSQIVELLHNSSLLIDDIEDNAPLRRGQTTSHLIFGVPSTINT
ANYMYFRAMQLVSQLTTKEPLYHNLITIFNEELINLHRGQGLDIYWRDFL
PEIIPTQEMYLNMVMNKTGGLFRLTLRLMEALSPSHSLVPFINLLGIIYQ
IRDDYLNLKDFQMGFAEDITEGKLSFPIVHALNFTKTKGQTEQHNEILRI
LLLRTSDKDIKLKLIQILEFDTNSLAYTKNFINQLVNMIKNDNENKYLP

3D structure

• PDB: 2zev Lipophilic bisphosphonates as dual farnesyl/geranylgeranyl diphosphate synthase inhibitors: an X-ray and NMR investigation
• Chain: B
• Resolution: 2.23 Å

Enzymatic activity

• Enzyme Commision number: 2.5.1.-
  2.5.1.1: dimethylallyltranstransferase.
  2.5.1.10: (2E,6E)-farnesyl diphosphate synthase.
  2.5.1.29: geranylgeranyl diphosphate synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MG	B	D80 D84	D73 D77
BS02	MG	B	D80 D84	D73 D77
BS03	IPE	B	R44 H73 L77 Y210	R37 H66 L70 Y199
BS04	B71	B	R44 H73 D80 R89 Q147 K174 F179 D214 K238	R37 H66 D73 R82 Q140 K167 F172 D203 K223

Gene Ontology

Molecular Function

• GO:0004161 dimethylallyltranstransferase activity
• GO:0004311 farnesyltranstransferase activity
• GO:0004337 geranyltranstransferase activity
• GO:0004659 prenyltransferase activity
• GO:0016740 transferase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0008299 isoprenoid biosynthetic process
• GO:0015031 protein transport
• GO:0016114 terpenoid biosynthetic process
• GO:0033384 geranyl diphosphate biosynthetic process
• GO:0033386 geranylgeranyl diphosphate biosynthetic process
• GO:0045337 farnesyl diphosphate biosynthetic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0005739 mitochondrion

External links

• PDB: RCSB:2zev, PDBe:2zev, PDBj:2zev
• PDBsum: 2zev
• PubMed: 19309137
• UniProt: Q12051|GGPPS_YEAST Geranylgeranyl pyrophosphate synthase BTS1 (Gene Name=BTS1)