Structure of PDB 2zet Chain B

Receptor sequence
>2zetB (length=174) Species: 10090 (Mus musculus) [Search protein sequence]
DYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYD
TFKVHLQLWDTAGLERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWM
SQLQANAYCENPDIVLIGNKADLPDQREVNERQARELAEKYGIPYFETSA
ATGQNVEKSVETLLDLIMKRMEKC
3D structure
PDB2zet Structural basis for the exclusive specificity of Slac2-a/melanophilin for the Rab27 GTPases.
ChainB
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.6.5.2: small monomeric GTPase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 MG B T23 T41 T19 T37
BS02 GTP B S18 G19 G21 K22 T23 T24 P36 K37 F38 T40 T41 G77 N133 K134 D136 L137 S163 A164 A165 S14 G15 G17 K18 T19 T20 P32 K33 F34 T36 T37 G63 N119 K120 D122 L123 S149 A150 A151
Gene Ontology
Molecular Function
GO:0003924 GTPase activity
GO:0003925 G protein activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0016787 hydrolase activity
GO:0019003 GDP binding
GO:0019904 protein domain specific binding
GO:0031489 myosin V binding
Biological Process
GO:0017157 regulation of exocytosis
GO:0045921 positive regulation of exocytosis
GO:0048488 synaptic vesicle endocytosis
GO:0071985 multivesicular body sorting pathway
GO:0099641 anterograde axonal protein transport
Cellular Component
GO:0005737 cytoplasm
GO:0005768 endosome
GO:0005770 late endosome
GO:0005794 Golgi apparatus
GO:0005795 Golgi stack
GO:0012505 endomembrane system
GO:0016020 membrane
GO:0016324 apical plasma membrane
GO:0030140 trans-Golgi network transport vesicle
GO:0030672 synaptic vesicle membrane
GO:0032585 multivesicular body membrane
GO:0042470 melanosome
GO:0042589 zymogen granule membrane
GO:0043231 intracellular membrane-bounded organelle
GO:1904115 axon cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2zet, PDBe:2zet, PDBj:2zet
PDBsum2zet
PubMed18940604
UniProtQ99P58|RB27B_MOUSE Ras-related protein Rab-27B (Gene Name=Rab27b)

[Back to BioLiP]