Structure of PDB 2zbw Chain B

Receptor sequence

>2zbwB (length=334) Species: 300852 (Thermus thermophilus HB8)

AADHTDVLIVGAGPTGLFAGFYVGMRGLSFRFVDPLPEPGGQLTALYPEK
YIYDVAGFPKVYAKDLVKGLVEQVAPFNPVYSLGERAETLEREGDLFKVT
TSQGNAYTAKAVIIAAGVGAFEPRRIGAPGEREFEGRGVYYAVKSKAEFQ
GKRVLIVGGGDSAVDWALNLLDTARRITLIHRRPQFRAHEASVKELMKAH
EEGRLEVLTPYELRRVEGDERVRWAVVFHNQTQEELALEVDAVLILAGYI
TKLGPLANWGLALEKNKIKVDTTMATSIPGVYACGDIVTYPGKLPLIVLG
FGEAAIAANHAAAYANPALKVNPGHSSEKAAPGT

3D structure

• PDB: 2zbw Crystal structure of thioredoxin reductase-like protein from Thermus thermophilus HB8
• Chain: B
• Resolution: 2.1 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): P40 L44 L47 K145 S146
• Catalytic site (residue number reindexed from 1): P39 L43 L46 K144 S145
• Enzyme Commision number: 1.18.1.2: ferredoxin--NADP(+) reductase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FAD	B	H326 S327 S328 E329	H325 S326 S327 E328
BS02	FAD	B	V11 G12 G14 P15 T16 V34 D35 P36 G42 Q43 L44 Y48 I53 D55 R87 A88 A116 A117 G118 G120 A121 F122 D287 P296 L297 I298	V10 G11 G13 P14 T15 V33 D34 P35 G41 Q42 L43 Y47 I52 D54 R86 A87 A115 A116 G117 G119 A120 F121 D286 P295 L296 I297

Gene Ontology

Molecular Function

• GO:0004324 ferredoxin-NADP+ reductase activity
• GO:0004791 thioredoxin-disulfide reductase (NADPH) activity
• GO:0016491 oxidoreductase activity
• GO:0050660 flavin adenine dinucleotide binding
• GO:0050661 NADP binding

Biological Process

• GO:0045454 cell redox homeostasis
• GO:0098869 cellular oxidant detoxification

External links

• PDB: RCSB:2zbw, PDBe:2zbw, PDBj:2zbw
• PDBsum: 2zbw
• UniProt: Q5SL28|FENR_THET8 Ferredoxin--NADP reductase (Gene Name=TTHA0465)