Structure of PDB 2z49 Chain B

Receptor sequence

>2z49B (length=431) Species: 40245 (Cucumaria echinata) [Search protein sequence]

VLCTNPLDIGELRSFKSKQCVDIVGNQGSGNIATYDCDGLSDQQIIICGD
GTIRNEARNYCFTPDGSGNANVMSSPCTLYPEIPSSQRWRQGRRKTFTDN
GGIEQVATEIINLASGKCLDIEGSDGTGDIGVYDCQNLDDQYFYVRSRGP
ELFYGRLRNEKSDLCLDVEGSDGKGNVLMYSCEDNLDQWFRYYENGEIVN
AKSGMCLDVEGSDGSGNVGIYRCDDLRDQMWSRPNAYCNGDYCSFLNKES
NKCLDVSGDQGTGDVGTWQCDGLPDQRFKWVFDDWEVPTATWNMVGCDQN
GKVSQQISNTISFSSTVTAGVAVEVSSTIEKGVIFAKATVSVKVTASLSK
AWTNSQSGTTAITYTCDNYDSDEEFTRGCMWQLAIETTEVKSGDLLVWNP
QIVKCTRSNTAPGCAPFTKCANEDCTFCTDI

3D structure

PDB

2z49 C-type lectin-like carbohydrate-recognition of the hemolytic lectin CEL-III containing ricin-type beta-trefoil folds

Chain

Resolution

1.95 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	AMG	B	D23 I24 V25 G26 Y36 D39	D22 I23 V24 G25 Y35 D38
BS02	AMG	B	D168 G171 Y181 E184	D167 G170 Y180 E183
BS03	AMG	B	D209 V210 G212 Y222	D208 V209 G211 Y221
BS04	AMG	B	D256 G259 W269	D255 G258 W268
BS05	AMG	B	D121 G124 Y134	D120 G123 Y133
BS06	CA	B	D23 I24 G26 D43	D22 I23 G25 D42
BS07	CA	B	D121 I122 G124 D141	D120 I121 G123 D140
BS08	CA	B	D168 V169 G171 D188	D167 V168 G170 D187
BS09	CA	B	D209 V210 G212 D229	D208 V209 G211 D228
BS10	CA	B	D256 V257 G259 D276	D255 V256 G258 D275
BS11	MG	B	N32 I33 N72 V73 I131	N31 I32 N71 V72 I130
BS12	MG	B	N177 V178 N218 V219 D265 V266	N176 V177 N217 V218 D264 V265

Gene Ontology

	Molecular Function
GO:0000287	magnesium ion binding
GO:0004653	polypeptide N-acetylgalactosaminyltransferase activity
GO:0005509	calcium ion binding
GO:0005534	galactose binding
GO:0030246	carbohydrate binding
GO:0030395	lactose binding
GO:0042806	fucose binding
GO:0046871	N-acetylgalactosamine binding
GO:0046872	metal ion binding
GO:1903777	melibiose binding

	Biological Process
GO:0001906	cell killing
GO:0006493	protein O-linked glycosylation
GO:0019731	antibacterial humoral response
GO:0031640	killing of cells of another organism
GO:0034120	positive regulation of erythrocyte aggregation
GO:0042742	defense response to bacterium
GO:0044179	hemolysis in another organism
GO:0050829	defense response to Gram-negative bacterium
GO:0050830	defense response to Gram-positive bacterium
GO:0051260	protein homooligomerization
GO:0051673	disruption of plasma membrane integrity in another organism

	Cellular Component
GO:0005576	extracellular region
GO:0005615	extracellular space
GO:0005794	Golgi apparatus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2z49, PDBe:2z49, PDBj:2z49
PDBsum	2z49
PubMed	17977832
UniProt	Q868M7\|CEL3_CUCEC Galactose/N-acetylgalactosamine-binding lectin CEL-III (Gene Name=cel3)

[Back to BioLiP]