Structure of PDB 2z30 Chain B |
>2z30B (length=65) Species: 69014 (Thermococcus kodakarensis KOD1) [Search protein sequence] |
TIRVIVSVDKAKFNPHEVLGIGGHIVYQFKLIPAVVVDVPANAVGKLKKM PGVEKVEFDHQAVLL |
|
PDB | 2z30 Four new crystal structures of Tk-subtilisin in unautoprocessed, autoprocessed and mature forms: insight into structural changes during maturation |
Chain | B |
Resolution | 1.65 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
B |
H28 D42 |
H24 D38 |
|
|
|