Structure of PDB 2yww Chain B

Receptor sequence
>2ywwB (length=142) Species: 2190 (Methanocaldococcus jannaschii) [Search protein sequence]
KVKKITNGTVIDHIDAGKALMVFKVLNVPKETSVMIAINVPSKKKGKKDI
LKIEGIELKKEDVDKISLISPDVTINIIRNGKVVEKLKPQIPDEIEGTLK
CTNPNCITNKEKVRGKFKIESKNPLKIRCYYCEKFLNEVIFE
3D structure
PDB2yww Crystal structure of aspartate carbamoyltransferase regulatory chain from Methanocaldococcus jannaschii
ChainB
Resolution2.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ATP B V9 K10 V2 K3
BS02 ZN B C108 C113 C136 C139 C101 C106 C129 C132
BS03 ATP B K11 I12 V17 D19 H20 K51 K59 I85 G88 V90 K93 K4 I5 V10 D12 H13 K44 K52 I78 G81 V83 K86
BS04 ATP B H20 M42 P48 S49 K50 K51 K55 K59 H13 M35 P41 S42 K43 K44 K48 K52
Gene Ontology
Molecular Function
GO:0046872 metal ion binding
Biological Process
GO:0006207 'de novo' pyrimidine nucleobase biosynthetic process
GO:0006221 pyrimidine nucleotide biosynthetic process
Cellular Component
GO:0009347 aspartate carbamoyltransferase complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2yww, PDBe:2yww, PDBj:2yww
PDBsum2yww
PubMed
UniProtQ58801|PYRI_METJA Aspartate carbamoyltransferase regulatory chain (Gene Name=pyrI)

[Back to BioLiP]