Structure of PDB 2y85 Chain B

Receptor sequence

>2y85B (length=236) Species: 83332 (Mycobacterium tuberculosis H37Rv)

MPLILLPAVDVVEGRAVRLVTEYGSAVDAALGWQRDGAEWIHLVDLDAAF
GRGSNHELLAEVVGKLDVQVELSGGIRDDESLAAALATGCARVNVGTAAL
ENPQWCARVIGEHGDQVAVGLDVQIIDGEHRLRGRGWETDGGDLWDVLER
LDSEGCSRFVVTDITKDGTLGGPNLDLLAGVADRTDAPVIASGGVSSLDD
LRAIATLTHRGVEGAIVGKALYARRFTLPQALAAVR

3D structure

• PDB: 2y85 Bisubstrate Specificity in Histidine/Tryptophan Biosynthesis Isomerase from Mycobacterium Tuberculosis by Active Site Metamorphosis.
• Chain: B
• Resolution: 2.4 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D11 D130
• Catalytic site (residue number reindexed from 1): D10 D122
• Enzyme Commision number: 5.3.1.16: 1-(5-phosphoribosyl)-5- [(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase.
  5.3.1.24: phosphoribosylanthranilate isomerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	137	B	D11 H50 V52 L54 S81 R143 D175 G176 S200 G201 V225 G226 K227	D10 H42 V44 L46 S73 R135 D167 G168 S192 G193 V217 G218 K219

Gene Ontology

Molecular Function

• GO:0003949 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase activity
• GO:0004640 phosphoribosylanthranilate isomerase activity
• GO:0016853 isomerase activity

Biological Process

• GO:0000105 L-histidine biosynthetic process
• GO:0000162 tryptophan biosynthetic process

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:2y85, PDBe:2y85, PDBj:2y85
• PDBsum: 2y85
• PubMed: 21321225
• UniProt: P9WMM5|HIS4_MYCTU Phosphoribosyl isomerase A (Gene Name=priA)