Structure of PDB 2xz1 Chain B

Receptor sequence

>2xz1B (length=348) Species: 3988 (Ricinus communis)

KPFMPPREVHVQVTHSMPPQKIEIFKSLDNWAEENILVHLKPVEKCWQPQ
DFLPDPASDGFDEQVRELRERAKEIPDDYFVVLVGDMITEEALPTYQTML
NTLDGVRDETGASPTSWAIWTRAWTAEENRHGDLLNKYLYLSGRVDMRQI
EKTIQYLIGSGMDPRTENSPYLGFIYTSFQERATFISHGNTARQAKEHGD
IKLAQICGTIAADEKRHETAYTKIVEKLFEIDPDGTVLAFADMMRKKISM
PAHLMYDGRDDNLFDHFSAVAQRLGVYTAKDYADILEFLVGRWKVDKLTG
LSAEGQKAQDYVCRLPPRIRRLEERAQGRAKEAPTMPFSWIFDRQVKL

3D structure

• PDB: 2xz1 Remote Control of Regioselectivity in Acyl-Acyl Carrier Protein-Desaturases.
• Chain: B
• Resolution: 3.35 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): W62 E105 E143 H146 E196 T199 D228 E229 H232
• Catalytic site (residue number reindexed from 1): W47 E90 E128 H131 E181 T184 D213 E214 H217
• Enzyme Commision number: 1.14.19.2: stearoyl-[acyl-carrier-protein] 9-desaturase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FE	B	E105 E143 H146 E229	E90 E128 H131 E214
BS02	FE	B	E143 E196 E229	E128 E181 E214
BS03	CA	B	E106 D148	E91 D133

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0016491 oxidoreductase activity
• GO:0045300 stearoyl-[ACP] desaturase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006631 fatty acid metabolic process
• GO:0006633 fatty acid biosynthetic process

Cellular Component

• GO:0009507 chloroplast

External links

• PDB: RCSB:2xz1, PDBe:2xz1, PDBj:2xz1
• PDBsum: 2xz1
• PubMed: 21930947
• UniProt: P22337|STAD_RICCO Stearoyl-[acyl-carrier-protein] 9-desaturase, chloroplastic