Structure of PDB 2xnj Chain B

Receptor sequence

>2xnjB (length=250) Species: 562 (Escherichia coli)

ADWVTGKVTKVQNWTDALFSLTVHAPVLPFTAGQFTKLGLEIDGERVQRA
YSYVNSPDNPDLEFYLVTVVYTNDAGEVVKGKLSPRLAALKPGDEVQVVS
EAAGFFVLDEVPHCETLWMLATGTAIGPYLSILRLGKDLDRFKNLVLVHA
ARYAADLSYLPLMQELEKRYEGKLRIQTVVSRETAAGSLTGRIPALIESG
ELESTIGLPMNKETSHVMLCGNPQMVRDTQQLLKETRQMTKHGHMTAEHY

3D structure

• PDB: 2xnj Swapping Fad Binding Motifs between Plastidic and Bacterial Ferredoxin-Nadp(H) Reductases.
• Chain: B
• Resolution: 1.9 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): F36 Y52 S53 C221 E254 Y256
• Catalytic site (residue number reindexed from 1): F35 Y51 S52 C220 E248 Y250
• Enzyme Commision number: 1.18.1.2: ferredoxin--NADP(+) reductase.
  1.19.1.1: flavodoxin--NADP(+) reductase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FAD	B	F36 R50 A51 Y52 S53 Y66 V70 Y72 G82 K83 L84 S85 T125 Y256	F35 R49 A50 Y51 S52 Y65 V69 Y71 G81 K82 L83 S84 T124 Y250	MOAD: Kd=1.1nM
BS02	NAP	B	A18 L19 V68 T69 V70 V71 T123 A152 R153 D157 S182 R183 R193 P195 N223 Q225 M226 D229	A17 L18 V67 T68 V69 V70 T122 A151 R152 D156 S181 R182 R192 P194 N222 Q224 M225 D228	MOAD: Kd=7.5uM
BS03	ZN	B	H25 D62	H24 D61
BS04	ZN	B	E111 H243	E110 H242

Gene Ontology

Molecular Function

• GO:0004324 ferredoxin-NADP+ reductase activity
• GO:0016491 oxidoreductase activity

External links

• PDB: RCSB:2xnj, PDBe:2xnj, PDBj:2xnj
• PDBsum: 2xnj
• PubMed: 21306142
• UniProt: P28861|FENR_ECOLI Flavodoxin/ferredoxin--NADP reductase (Gene Name=fpr)