Structure of PDB 2xma Chain B

Receptor sequence

>2xmaB (length=135) Species: 1299 (Deinococcus radiodurans)

TYVILPLEMKKGRGYVYQLEYHLIWCVKYRHQVLVGEVADGLKDILRDIA
AQNGLEVITMEVMPDHVHLLLSATPQQAIPDFVKALKGASARRMFVAYPQ
LKEKLWGGNLWNPSYCILTVSENTRAQIQKYIESQ

3D structure

• PDB: 2xma DNA Recognition and the Precleavage State During Single-Stranded DNA Transposition in D. Radiodurans.
• Chain: B
• Resolution: 2.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	B	K12 R14 Y16 V17 Y132	K11 R13 Y15 V16 Y131
BS02	dna	B	C27 K29 Y30 R31 H32 H69 P81 K85 K88 G89 A90 A92 R93 F96 K105 W107 G108 N110 L111 W112 N113 P114 S115 Y116	C26 K28 Y29 R30 H31 H68 P80 K84 K87 G88 A89 A91 R92 F95 K104 W106 G107 N109 L110 W111 N112 P113 S114 Y115

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0004519 endonuclease activity
• GO:0004803 transposase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006310 DNA recombination
• GO:0006313 DNA transposition
• GO:0032196 transposition

External links

• PDB: RCSB:2xma, PDBe:2xma, PDBj:2xma
• PDBsum: 2xma
• PubMed: 20890269
• UniProt: Q7DF83|DRA2A_DEIRA ISDra2 transposase TnpA (Gene Name=tnpA)