Structure of PDB 2xk5 Chain B |
>2xk5B (length=75) Species: 9606 (Homo sapiens) [Search protein sequence] |
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPQQQRLIFAGKQL EDGRTLSDYNIQKESTLHLVLRLRG |
|
PDB | 2xk5 Engineered Diubiquitin Synthesis Reveals K29-Isopeptide Specificity of an Otu Deubiquitinase |
Chain | B |
Resolution | 3.0 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
B |
E18 D21 |
E18 D21 |
|
|
|