Structure of PDB 2xd0 Chain B

Receptor sequence

>2xd0B (length=162) Species: 29471 (Pectobacterium atrosepticum)

MKFYTISSKYIEYLKEFDDKVPNSEDPTYQNPKAFIGIVLEIQGHKYLAP
LTSPKKWHNNVKESSLSCFKLHENGVPENQLGLINLKFMIPIIEAEVSLL
DLGNMPNTPYKRMLYKQLQFIRANSDKIASKSDTLRNLVLQGKMQGTCNF
SLLEEKYRDFGK

3D structure

• PDB: 2xd0 A processed noncoding RNA regulates an altruistic bacterial antiviral system.
• Chain: B
• Resolution: 3.0 Å

Enzymatic activity

• Enzyme Commision number: 3.1.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	B	D19 K20 V21 P22 N23 W57 K62 E63 L66 F88 N137 L138 M144	D19 K20 V21 P22 N23 W57 K62 E63 L66 F88 N137 L138 M144
BS02	rna	B	K2 F3 Y29 N31 K33 T52 S53 P54 E73 N74 N79 L81 L99 L100 L102 P109 Y110 M113 Y115 K116 Q119 R122 A123	K2 F3 Y29 N31 K33 T52 S53 P54 E73 N74 N79 L81 L99 L100 L102 P109 Y110 M113 Y115 K116 Q119 R122 A123

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0004519 endonuclease activity
• GO:0004521 RNA endonuclease activity
• GO:0042802 identical protein binding

Biological Process

• GO:0006276 plasmid maintenance
• GO:0045892 negative regulation of DNA-templated transcription
• GO:0051607 defense response to virus

External links

• PDB: RCSB:2xd0, PDBe:2xd0, PDBj:2xd0
• PDBsum: 2xd0
• PubMed: 21240270
• UniProt: B8X8Z0|TOXN_PECAT Endoribonuclease ToxN (Gene Name=toxN)