Structure of PDB 2xcp Chain B

Receptor sequence

>2xcpB (length=342) Species: 273057 (Saccharolobus solfataricus P2)

HMIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYE
ARKFGVKAGIPIVEAKKILPNAVYLPMRKEVYQQVSSRIMNLLREYSEKI
EIASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKV
FAKIAADMAKPNGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGI
NKLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYNEPIRTRVRKSIGRIV
TMKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRG
RTFPHGISKETAYSESVKLLQKILEEDERKIRRIGVRFSKFI

3D structure

• PDB: 2xcp Metal Ion Dependence of the Active Site Conformation of the Trans-Lesion DNA Polymerase Dpo4 from Sulfolobus Solfataricus
• Chain: B
• Resolution: 2.6 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.7: DNA-directed DNA polymerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	B	K152 G185 G187 I189 T190 S297 R298 G299 T301 I341	K153 G186 G188 I190 T191 S298 R299 G300 T302 I342
BS02	dna	B	V32 S34 S40 G41 A42 P60 A220 R242 K243 S244 I245 G246 R247 I248 T250 L293 R331 R332 R336	V33 S35 S41 G42 A43 P61 A221 R243 K244 S245 I246 G247 R248 I249 T251 L294 R332 R333 R337
BS03	MG	B	D7 F8 D105	D8 F9 D106
BS04	MG	B	D7 D105 E106	D8 D106 E107
BS05	DCP	B	F8 D9 Y10 Y12 T45 Y48 R51 D105 K159	F9 D10 Y11 Y13 T46 Y49 R52 D106 K160

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0003677 DNA binding
• GO:0003684 damaged DNA binding
• GO:0003887 DNA-directed DNA polymerase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006260 DNA replication
• GO:0006261 DNA-templated DNA replication
• GO:0006281 DNA repair
• GO:0006974 DNA damage response
• GO:0042276 error-prone translesion synthesis

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:2xcp, PDBe:2xcp, PDBj:2xcp
• PDBsum: 2xcp
• PubMed: 20823515
• UniProt: Q97W02|DPO4_SACS2 DNA polymerase IV (Gene Name=dbh)