Structure of PDB 2xcn Chain B

Receptor sequence
>2xcnB (length=153) [Search protein sequence]
QVEGEVQIVSTATQTFLATCINGVCWTVYHGAGTRTIASPKGPVIQMYTN
VDQDLVGWPAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLL
SPRPISYLKGSSGGPLLCPAGHAVGLFRAAVCTRGVAKAVDFIPVENLET
TMR
3D structure
PDB2xcn Synthesis and Evaluation of Novel Alpha-Amino Cyclic Boronates as Inhibitors of Hcv Ns3 Protease.
ChainB
Resolution3.02 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) H57 D81 G137 S139
Catalytic site (residue number reindexed from 1) H30 D54 G110 S112
Enzyme Commision number 3.6.4.13: RNA helicase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide B G31 A111 G4 A84
BS02 peptide B V29 G31 E32 V33 I35 V36 S37 R62 T63 I64 W85 G90 V2 G4 E5 V6 I8 V9 S10 R35 T36 I37 W58 G63
BS03 C8D B H57 D81 R123 S139 R155 A156 A157 H30 D54 R96 S112 R128 A129 A130
BS04 ZN B C97 C99 C145 C70 C72 C118
Gene Ontology
Molecular Function
GO:0008233 peptidase activity
GO:0008236 serine-type peptidase activity
GO:0046872 metal ion binding
Biological Process
GO:0006508 proteolysis
GO:0019062 virion attachment to host cell
GO:0019087 transformation of host cell by virus
GO:0046718 symbiont entry into host cell
GO:0097264 self proteolysis
Cellular Component
GO:0016020 membrane
GO:0033644 host cell membrane
GO:0044423 virion component

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2xcn, PDBe:2xcn, PDBj:2xcn
PDBsum2xcn
PubMed20493689
UniProtQ91RS4

[Back to BioLiP]