Structure of PDB 2x1h Chain B

Receptor sequence

>2x1hB (length=339) Species: 9606 (Homo sapiens)

MMQKLVVTRLSPNFREAVTLSRDCPVPLPGDGDLLVRNRFVGVNASDINY
SAGRYDPSVKPPFDIGFEGIGEVVALGLSASARYTVGQAVAYMAPGSFAE
YTVVPASIATPVPSVKPEYLTLLVSGTTAYISLKELGGLSEGKKVLVTAA
AGGTGQFAMQLSKKAKCHVIGTCSSDEKSAFLKSLGCDRPINYKTEPVGT
VLKQEYPEGVDVVYESVGGAMFDLAVDALATKGRLIVIGFISGYQTPTGL
SPVKAGTLPAKLLKKSASVQGFFLNHYLSKYQAAMSHLLEMCVSGDLVCE
VDLGDLSPEGRFTGLESIFRAVNYMYMGKNTGKIVVELP

3D structure

• PDB: 2x1h Crystal Structure of the Human Mgc45594 Gene Product in Complex with Raloxifene
• Chain: B
• Resolution: 1.75 Å

Enzymatic activity

• Enzyme Commision number: 1.3.1.48: 15-oxoprostaglandin 13-reductase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NAP	B	A67 T150 G174 G175 T176 S196 K200 Y215 S238 I260 G261 I263 Y266 L296 M347 G350 N352	A45 T128 G152 G153 T154 S174 K178 Y193 S216 I238 G239 I241 Y244 L274 M325 G328 N330
BS02	X1H	B	S68 N71 R76 Y77 F262 Y266 T270 L272 F295	S46 N49 R54 Y55 F240 Y244 T248 L250 F273
BS03	X1H	B	Y152 L155 K156 L183 K186 A187 H309 M313	Y130 L133 K134 L161 K164 A165 H287 M291

Gene Ontology

Molecular Function

• GO:0003674 molecular_function
• GO:0003824 catalytic activity
• GO:0008270 zinc ion binding
• GO:0016491 oxidoreductase activity
• GO:0047522 15-oxoprostaglandin 13-oxidase [NAD(P)+] activity

Biological Process

• GO:0006629 lipid metabolic process
• GO:0008150 biological_process
• GO:0045599 negative regulation of fat cell differentiation

Cellular Component

• GO:0005739 mitochondrion
• GO:0005777 peroxisome

External links

• PDB: RCSB:2x1h, PDBe:2x1h, PDBj:2x1h
• PDBsum: 2x1h
• UniProt: Q8N4Q0|PTGR3_HUMAN Prostaglandin reductase 3 (Gene Name=PTGR3)