Structure of PDB 2wya Chain B

Receptor sequence

>2wyaB (length=460) Species: 9606 (Homo sapiens) [Search protein sequence]

SMPKDVGILALEVYFPAQYVDQTDLEKYNNVEAGKYTVGLGQTRMGFCSV
QEDINSLCLTVVQRLMERIQLPWDSVGRLEVGTETIIDKSKAVKTVLMEL
FQDSGNTDIEGIDTTNACYGGTASLFNAANWMESSSWDGRYAMVVCGDIA
VYPSGNARPTGGAGAVAMLIGPKAPLALERGLRGTHMENVYDFYKPNLAS
EYPIVDGKLSIQCYLRALDRCYTSYRKKIQNQWKQAGSDRPFTLDDLQYM
IFHTPFCKMVQKSLARLMFNDFLSASSDTQTSLYKGLEAFGGLKLEDTYT
NKDLDKALLKASQDMFDKKTKASLYLSTHNGNMYTSSLYGCLASLLSHHS
AQELAGSRIGAFSYGSGLAASFFSFRVSQDAAPGSPLDKLVSSTSDLPKR
LASRKCVSPEEFTEIMNQREQFYHKVNFSPPGDTNSLFPGTWYLERVDEQ
HRRKYARRPV

3D structure

PDB

2wya Crystal Structures of Human Hmg-Coa Synthase Isoforms Provide Insights Into Inherited Ketogenesis Disorders and Inhibitor Design.

Chain

Resolution

1.7 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

2.3.3.10: hydroxymethylglutaryl-CoA synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HMG	B	G82 K83 V86 G87 E132 A165 C166 Y200 N204 A205 T208 F241 G255 S258 H301 P303 F304 K306 K310 Y412 G413 S414	G34 K35 V38 G39 E84 A117 C118 Y152 N156 A157 T160 F193 G207 S210 H253 P255 F256 K258 K262 Y364 G365 S366

Gene Ontology

	Molecular Function
GO:0004421	hydroxymethylglutaryl-CoA synthase activity
GO:0016740	transferase activity
GO:0016746	acyltransferase activity
GO:0042802	identical protein binding

	Biological Process
GO:0001822	kidney development
GO:0001889	liver development
GO:0006084	acetyl-CoA metabolic process
GO:0006695	cholesterol biosynthetic process
GO:0007494	midgut development
GO:0007584	response to nutrient
GO:0008299	isoprenoid biosynthetic process
GO:0009266	response to temperature stimulus
GO:0009410	response to xenobiotic stimulus
GO:0009617	response to bacterium
GO:0010038	response to metal ion
GO:0010142	farnesyl diphosphate biosynthetic process, mevalonate pathway
GO:0014070	response to organic cyclic compound
GO:0030324	lung development
GO:0032868	response to insulin
GO:0032869	cellular response to insulin stimulus
GO:0032870	cellular response to hormone stimulus
GO:0033555	multicellular organismal response to stress
GO:0033574	response to testosterone
GO:0033762	response to glucagon
GO:0034014	response to triglyceride
GO:0034284	response to monosaccharide
GO:0034696	response to prostaglandin F
GO:0042594	response to starvation
GO:0043434	response to peptide hormone
GO:0045471	response to ethanol
GO:0046951	ketone body biosynthetic process
GO:0051384	response to glucocorticoid
GO:0051591	response to cAMP
GO:0060416	response to growth hormone
GO:0060612	adipose tissue development
GO:0070542	response to fatty acid
GO:0070543	response to linoleic acid
GO:0071222	cellular response to lipopolysaccharide
GO:0071230	cellular response to amino acid stimulus
GO:0071385	cellular response to glucocorticoid stimulus
GO:0071398	cellular response to fatty acid
GO:0071407	cellular response to organic cyclic compound

	Cellular Component
GO:0005739	mitochondrion
GO:0005759	mitochondrial matrix

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2wya, PDBe:2wya, PDBj:2wya
PDBsum	2wya
PubMed	20346956
UniProt	P54868\|HMCS2_HUMAN Hydroxymethylglutaryl-CoA synthase, mitochondrial (Gene Name=HMGCS2)

[Back to BioLiP]