Structure of PDB 2wwg Chain B

Receptor sequence

>2wwgB (length=210) Species: 36329 (Plasmodium falciparum 3D7)

MTDDKKKGKFIVFEGLDRSGKSTQSKLLVEYLKNNNVEVKHLYFPNRETG
IGQIISKYLKMENSMSNETIHLLFSANRWEHMNEIKSLLLKGIWVVCDRY
AYSGVAYSSGALNLNKTWCMNPDQGLIKPDVVFYLNVPPNYAQNRSDYGE
EIYEKVETQKKIYETYKHFAHEDYWINIDATRKIEDIHNDIVKEVTKIKV
EPEEFNFLWS

3D structure

• PDB: 2wwg Structural Basis for the Efficient Phosphorylation of Aztmp and Dgmp by Plasmodium Falciparum Type I Thymidylate Kinase.
• Chain: B
• Resolution: 2.4 Å

Enzymatic activity

• Enzyme Commision number: 2.7.4.8: guanylate kinase.
  2.7.4.9: dTMP kinase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ADP	B	A170 H171	A170 H171
BS02	DGP	B	D17 R47 L59 F74 R78 R99 G104 Y107 S108 Y153	D17 R47 L59 F74 R78 R99 G104 Y107 S108 Y153
BS03	ADP	B	R18 G20 K21 S22 T23 R145 I184	R18 G20 K21 S22 T23 R145 I184

Gene Ontology

Molecular Function

• GO:0004385 guanylate kinase activity
• GO:0004550 nucleoside diphosphate kinase activity
• GO:0004798 thymidylate kinase activity
• GO:0005524 ATP binding
• GO:0016301 kinase activity
• GO:0050316 T2-induced deoxynucleotide kinase activity

Biological Process

• GO:0006177 GMP biosynthetic process
• GO:0006227 dUDP biosynthetic process
• GO:0006233 dTDP biosynthetic process
• GO:0006235 dTTP biosynthetic process
• GO:0009165 nucleotide biosynthetic process
• GO:0016310 phosphorylation
• GO:0046710 GDP metabolic process
• GO:0046940 nucleoside monophosphate phosphorylation

Cellular Component

• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0005739 mitochondrion

External links

• PDB: RCSB:2wwg, PDBe:2wwg, PDBj:2wwg
• PDBsum: 2wwg
• PubMed: 20353400
• UniProt: Q8I4S1|KTHY_PLAF7 Thymidylate kinase (Gene Name=TMK)