Structure of PDB 2wv4 Chain B

Receptor sequence

>2wv4B (length=196) Species: 12112 (Foot-and-mouth disease virus (strain A10-61))

TDLQKMVMGNTKPVELILDGKTVAICCATGVFGTAYLVPRHLFAEKYDKI
MLDGRAMTDSDYRVFEFEIKVKMLSDAALMVLHRGNKVRDITKHFRDTAR
MKKGTPVVGVVNNADVGRLIFSGEALTYKDIVVLMDGDTMPGLFAYKAAT
RAGYAGGAVLAADTFIVGTHSAGGNGVGYCSCVSRSMLQKMKAHVD

3D structure

• PDB: 2wv4 Insights Into Cleavage Specificity from the Crystal Structure of Foot-and-Mouth Disease Virus 3C Protease Complexed with a Peptide Substrate.
• Chain: B
• Resolution: 2.5 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H46 D84 A163 S182
• Catalytic site (residue number reindexed from 1): H41 D76 A155 S171
• Enzyme Commision number: 2.7.7.48: RNA-directed RNA polymerase.
  3.4.22.28: picornain 3C.
  3.4.22.46: L-peptidase.
  3.6.1.15: nucleoside-triphosphate phosphatase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	B	T27 V28 A29 I30 C31 H46 L47 E50 L142 M143 D144 D146 T158 R159 A160 G161 A163 H181 A183 G184 Y190	T22 V23 A24 I25 C26 H41 L42 E45 L134 M135 D136 D138 T150 R151 A152 G153 A155 H170 A172 G173 Y179

Gene Ontology

Molecular Function

• GO:0004197 cysteine-type endopeptidase activity

Biological Process

• GO:0006508 proteolysis

External links

• PDB: RCSB:2wv4, PDBe:2wv4, PDBj:2wv4
• PDBsum: 2wv4
• PubMed: 19883658
• UniProt: P03306|POLG_FMDV1 Genome polyprotein