Structure of PDB 2wo8 Chain B

Receptor sequence

>2wo8B (length=163) Species: 9606 (Homo sapiens)

MGPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINT
GMADILVVFARGAHGDFHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWT
THSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADD
IRGIQSLYGDPKE

3D structure

• PDB: 2wo8 The Identification of Beta-Hydroxy Carboxylic Acids as Selective Mmp-12 Inhibitors.
• Chain: B
• Resolution: 2.0 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H218 E219 H222 H228
• Catalytic site (residue number reindexed from 1): H114 E115 H118 H124
• Enzyme Commision number: 3.4.24.65: macrophage elastase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	023	B	G179 I180 L181 L214 T215 H218 E219 H222 H228 P238 T239 Y240 K241	G75 I76 L77 L110 T111 H114 E115 H118 H124 P134 T135 Y136 K137
BS02	ZN	B	H218 H222 H228	H114 H118 H124
BS03	ZN	B	H168 D170 H183 H196	H64 D66 H79 H92
BS04	CA	B	D175 G176 G178 I180 D198 E201	D71 G72 G74 I76 D94 E97
BS05	CA	B	D158 G190 G192 D194	D54 G86 G88 D90

Gene Ontology

Molecular Function

• GO:0004222 metalloendopeptidase activity
• GO:0008237 metallopeptidase activity
• GO:0008270 zinc ion binding

Biological Process

• GO:0006508 proteolysis

Cellular Component

• GO:0031012 extracellular matrix

External links

• PDB: RCSB:2wo8, PDBe:2wo8, PDBj:2wo8
• PDBsum: 2wo8
• PubMed: 19703773
• UniProt: P39900|MMP12_HUMAN Macrophage metalloelastase (Gene Name=MMP12)