Structure of PDB 2wnv Chain B |
>2wnvB (length=131) Species: 9606 (Homo sapiens) [Search protein sequence] |
TQKIAFSATRTIVPLRRDQTIRFDHVITNMNNNYEPRSGKFTCKVPGLYY FTYHASSRGNLCVNLMRGRERAQKVVTFCDYAYNTFQVTTGGMVLKLEQG ENVFLQATDKNSLLGMEGANSIFSGFLLFPD |
|
PDB | 2wnv Cutting Edge: C1Q Binds Deoxyribose and Heparan Sulfate Through Neighboring Sites of its Recognition Domain. |
Chain | B |
Resolution | 1.25 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
B |
D172 Y173 Q179 |
D80 Y81 Q87 |
|
|
|