Structure of PDB 2wb4 Chain B

Receptor sequence

>2wb4B (length=441) Species: 190650 (Caulobacter vibrioides CB15)

SARILVVDDIEANVRLLEAKLTAEYYEVSTAMDGPTALAMAARDLPDIIL
LDVMMPGMDGFTVCRKLKDDPTTRHIPVVLITALDGRGDRIQGLESGASD
FLTKPIDDVMLFARVRSLTRFKLVIDELRQREASGLDGLGGRVLIVDDNE
RQAQRVAAELGVEHRPVIESDPEKAKISAGGPVDLVIVNAAAKNFDGLRF
TAALRSEERTRQLPVLAMVDPDDRGRMVKALEIGVNDILSRPIDPQELSA
RVKTQIQRKRYTDYLRNNLDHSLELAVTDQLTGLHNRRYMTGQLDSLVKR
ATLGGDPVSALLIDIDFFKKINDTFGHDIGDEVLREFALRLASNVRAIDL
PCRYGGEEFVVIMPDTALADALRIAERIRMHVSGSPFTVAHGREMLNVTI
SIGVSATAGEGDTPEALLKRADEGVYQAKASGRNAVVGKAA

3D structure

• PDB: 2wb4 Crystal Structure of Activated Pled, Identification of Dimerization and Catalysis Relevant Regulatory Mechanisms
• Chain: B
• Resolution: 2.8 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.65: diguanylate cyclase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	C2E	B	K312 R313 L316	K299 R300 L303
BS02	BEF	B	D53 V54 M55 T83 A84 K105	D52 V53 M54 T82 A83 K104
BS03	MG	B	D10 D53 M55	D9 D52 M54
BS04	C2E	B	R359 D362 D383 I387 R390	R346 D349 D370 I374 R377
BS05	C2E	B	N357 R359 R390	N344 R346 R377
BS06	C2E	B	F331 N335 D344 R366 G369 E370	F318 N322 D331 R353 G356 E357
BS07	MG	B	G369 E370 E371	G356 E357 E358

Gene Ontology

Molecular Function

• GO:0005525 GTP binding
• GO:0016740 transferase activity
• GO:0046872 metal ion binding
• GO:0052621 diguanylate cyclase activity

Biological Process

• GO:0000160 phosphorelay signal transduction system
• GO:0030154 cell differentiation
• GO:0043709 cell adhesion involved in single-species biofilm formation
• GO:1902201 negative regulation of bacterial-type flagellum-dependent cell motility

Cellular Component

• GO:0005737 cytoplasm
• GO:0005886 plasma membrane

External links

• PDB: RCSB:2wb4, PDBe:2wb4, PDBj:2wb4
• PDBsum: 2wb4
• UniProt: B8GZM2|PLED_CAUVN Response regulator PleD (Gene Name=pleD)