Structure of PDB 2wa9 Chain B

Receptor sequence
>2wa9B (length=86) Species: 562 (Escherichia coli) [Search protein sequence]
KPPSMYKVILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKAI
CGVFTAEVAETKVAMVNKYARENEHPLLCTLEKAGA
3D structure
PDB2wa9 Structural Basis of N-End Rule Substrate Recognition in Escherichia Coli by the Clpap Adaptor Protein Clps.
ChainB
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide B N34 D35 D36 T38 M40 H66 N12 D13 D14 T16 M18 H44
BS02 peptide B K23 P24 K1 P2
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0051087 protein-folding chaperone binding
GO:0140678 molecular function inhibitor activity
Biological Process
GO:0006508 proteolysis
GO:0009408 response to heat
GO:0030163 protein catabolic process

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2wa9, PDBe:2wa9, PDBj:2wa9
PDBsum2wa9
PubMed19373253
UniProtP0A8Q6|CLPS_ECOLI ATP-dependent Clp protease adapter protein ClpS (Gene Name=clpS)

[Back to BioLiP]