Structure of PDB 2w98 Chain B

Receptor sequence

>2w98B (length=355) Species: 9606 (Homo sapiens)

MMIVQRVVLNSRPGKNGNPVAENFRMEEVYLPDNINEGQVQVRTLYLSVD
PYMRCRMNEDTGTDYITPWQLSQVVDGGGIGIIEESKHTNLTKGDFVTSF
YWPWQTKVILDGNSLEKVDPQLVDGHLSYFLGAIGMPGLTSLIGIQEKGH
ITAGSNKTMVVSGAAGACGSVAGQIGHFLGCSRVVGICGTHEKCILLTSE
LGFDAAINYKKDNVAEQLRESCPAGVDVYFDNVGGNISDTVISQMNENSH
IILCGQISQYNKDVPYPPPLSPAIEAIQKERNITRERFLVLNYKDKFEPG
ILQLSQWFKEGKLKIKETVINGLENMGAAFQSMMTGGNIGKQIVCISEEI
AENLY

3D structure

• PDB: 2w98 Crystal Structure of Human Zinc-Binding Alcohol Dehydrogenase 1
• Chain: B
• Resolution: 1.85 Å

Enzymatic activity

• Enzyme Commision number: 1.3.1.48: 15-oxoprostaglandin 13-reductase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NAP	B	P50 T139 G165 A166 C167 C187 G188 K192 Y208 N231 V232 C253 G254 I256 Y259 L288 V289 M332 M333 G335 N337	P51 T140 G166 A167 C168 C188 G189 K193 Y209 N232 V233 C254 G255 I257 Y260 L289 V290 M333 M334 G336 N338
BS02	P1Z	B	Y51 I65 Y259 Y265 L288	Y52 I66 Y260 Y266 L289
BS03	P1Z	B	L290 N291 K293 D294	L291 N292 K294 D295
BS04	P1Z	B	F99 Y100 L290	F100 Y101 L291
BS05	P1Z	B	T97 E115	T98 E116

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0005515 protein binding
• GO:0008270 zinc ion binding
• GO:0016491 oxidoreductase activity
• GO:0016628 oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor
• GO:0047522 15-oxoprostaglandin 13-oxidase [NAD(P)+] activity

Biological Process

• GO:0006629 lipid metabolic process
• GO:0006693 prostaglandin metabolic process

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:2w98, PDBe:2w98, PDBj:2w98
• PDBsum: 2w98
• UniProt: Q8N8N7|PTGR2_HUMAN Prostaglandin reductase 2 (Gene Name=PTGR2)