Structure of PDB 2w97 Chain B

Receptor sequence

>2w97B (length=177) Species: 9606 (Homo sapiens) [Search protein sequence]

NPEHYIKHPLQNRWALWFFKKNLRLISKFDTVEDFWALYNHIQLSSNLMP
GCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRSDLDRFWLETLLCL
IGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENREAVTHIGRVYKERL
GLPPKIVIGYQSHADTATKTTKNRFVV

3D structure

PDB

2w97 Crystallization of eIF4E complexed with eIF4GI peptide and glycerol reveals distinct structural differences around the cap-binding site.

Chain

Resolution

2.29 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	B	H37 P38 Q40 V69 E70 W73 N77 E132 L135 G139	H8 P9 Q11 V32 E33 W36 N40 E95 L98 G102
BS02	GOL	B	H200 T203	H163 T166

Gene Ontology

	Molecular Function
GO:0000339	RNA cap binding
GO:0000340	RNA 7-methylguanosine cap binding
GO:0003723	RNA binding
GO:0003743	translation initiation factor activity
GO:0005515	protein binding
GO:0019899	enzyme binding
GO:0031370	eukaryotic initiation factor 4G binding
GO:0098808	mRNA cap binding
GO:0140297	DNA-binding transcription factor binding

	Biological Process
GO:0000082	G1/S transition of mitotic cell cycle
GO:0001662	behavioral fear response
GO:0006406	mRNA export from nucleus
GO:0006412	translation
GO:0006413	translational initiation
GO:0006417	regulation of translation
GO:0010507	negative regulation of autophagy
GO:0017148	negative regulation of translation
GO:0019827	stem cell population maintenance
GO:0030182	neuron differentiation
GO:0045665	negative regulation of neuron differentiation
GO:0045931	positive regulation of mitotic cell cycle
GO:0051028	mRNA transport
GO:0051168	nuclear export
GO:0071549	cellular response to dexamethasone stimulus
GO:0099578	regulation of translation at postsynapse, modulating synaptic transmission

	Cellular Component
GO:0000932	P-body
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0010494	cytoplasmic stress granule
GO:0016281	eukaryotic translation initiation factor 4F complex
GO:0016442	RISC complex
GO:0016604	nuclear body
GO:0016607	nuclear speck
GO:0033391	chromatoid body
GO:0036464	cytoplasmic ribonucleoprotein granule
GO:0048471	perinuclear region of cytoplasm
GO:0070062	extracellular exosome
GO:0098794	postsynapse
GO:0098978	glutamatergic synapse

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2w97, PDBe:2w97, PDBj:2w97
PDBsum	2w97
PubMed	19440045
UniProt	P06730\|IF4E_HUMAN Eukaryotic translation initiation factor 4E (Gene Name=EIF4E)

[Back to BioLiP]