Structure of PDB 2w7p Chain B

Receptor sequence

>2w7pB (length=430) Species: 9606 (Homo sapiens)

KEKINKIIMEATKGSRFYGNELKKEKQVNQRIENMMQQKAQITSQQLRKA
QLQVDRFAMELEQSRNLSNTIVHIDMDAFYAAVEMRDNPELKDKPIAVGS
MSMLSTSNYHARRFGVRAAMPGFIAKRLCPQLIIVPPNFDKYRAVSKEVK
EILADYDPNFMAMSLDEAYLNITKHLEERQNWPEDKRRYFINSVVFGTSA
QEVVKEIRFRIEQKTTLTASAGIAPNTMLAKVCSDKNKPNGQYQILPNRQ
AVMDFIKDLPIRKVSGIGKVTEKMLKALGIITCTELYQQRALLSLLFSET
SWHYFLHISLGLGSTHLTRDGERKSMSVERTFSEINKAEEQYSLCQELCS
ELAQDLQKERLKGRTVTIKLKNVNFEVKTRASTVSSVVSTAEEIFAIAKE
LLKTEIDADFPHPLRLRLMGVRISSFPNEE

3D structure

• PDB: 2w7p Structural and Functional Elucidation of the Mechanism Promoting Error-Prone Synthesis by Human DNA Polymerase Kappa Opposite the 7,8-Dihydro-8-Oxo-2'-Deoxyguanosine Adduct.
• Chain: B
• Resolution: 3.71 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.7: DNA-directed DNA polymerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	B	S196 D198 E199 K321 S355 I357 G358 V360 T361 K468 T469 R470 A471 E520	S164 D166 E167 K231 S265 I267 G268 V270 T271 K378 T379 R380 A381 E430
BS02	dna	B	T44 F49 R63 M135 P153 F155 I156 S388 S391 R413 K414 S415 M416 S417 V418 E419 R420 T421 R507	T12 F17 R31 M103 P121 F123 I124 S298 S301 R323 K324 S325 M326 S327 V328 E329 R330 T331 R417
BS03	DTP	B	D107 A110 S137 R144 D198 K328	D75 A78 S105 R112 D166 K238
BS04	CA	B	D107 K321 D325	D75 K231 D235
BS05	CA	B	D107 M108 D198	D75 M76 D166

Gene Ontology

Molecular Function

• GO:0003684 damaged DNA binding
• GO:0003887 DNA-directed DNA polymerase activity

Biological Process

• GO:0006281 DNA repair

External links

• PDB: RCSB:2w7p, PDBe:2w7p, PDBj:2w7p
• PDBsum: 2w7p
• PubMed: 19542228
• UniProt: Q9UBT6|POLK_HUMAN DNA polymerase kappa (Gene Name=POLK)