Structure of PDB 2w57 Chain B

Receptor sequence
>2w57B (length=131) Species: 666 (Vibrio cholerae) [Search protein sequence]
DNNQALKDAGLKVTLPRLKILEVLQQPECQHISAEELYKKLIDLGEEIGL
ATVYRVLNQFDDAGIVTRHHFEGGKSVFELSTQHHHDHLVCLDCGEVIEF
SDDVIEQRQKEIAAKYNVQLTNHSLYLYGKC
3D structure
PDB2w57 Crystal Structure of the Vibrio Cholerae Ferric Uptake Regulator (Fur) Reveals Insights Into Metal Co-Ordination.
ChainB
Resolution2.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN B H87 D89 E108 H125 H85 D87 E106 H123
BS02 ZN B H33 E81 H88 H90 H31 E79 H86 H88
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0045892 negative regulation of DNA-templated transcription
GO:1900705 negative regulation of siderophore biosynthetic process
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2w57, PDBe:2w57, PDBj:2w57
PDBsum2w57
PubMed19400801
UniProtP0C6C8|FUR_VIBCH Ferric uptake regulation protein (Gene Name=fur)

[Back to BioLiP]