Structure of PDB 2w2v Chain B

Receptor sequence

>2w2vB (length=170) Species: 9606 (Homo sapiens) [Search protein sequence]

QAIKCVVVGDVAVGKTCLLISYTTNAFPGIPTVFDNYSANVMVDSKPVNL
GLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRH
HCPSTPIILVGTKLDLRDDKDTIEKLKLAPITYPQGLALAKEIDSVKYLE
CSALTQRGLKTVFDEAIRAV

3D structure

PDB

2w2v Structural Insights Into Formation of an Active Signaling Complex between Rac and Phospholipase C Gamma 2.

Chain

Resolution

2.0 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GTP	B	A13 G15 K16 T17 C18 F28 I33 D57 K116 D118 A159 L160	A12 G14 K15 T16 C17 F27 I30 D54 K113 D115 A153 L154

Gene Ontology

	Molecular Function
GO:0003924	GTPase activity
GO:0005515	protein binding
GO:0005525	GTP binding
GO:0019887	protein kinase regulator activity

	Biological Process
GO:0006935	chemotaxis
GO:0007015	actin filament organization
GO:0007165	signal transduction
GO:0007186	G protein-coupled receptor signaling pathway
GO:0007264	small GTPase-mediated signal transduction
GO:0008283	cell population proliferation
GO:0010310	regulation of hydrogen peroxide metabolic process
GO:0010592	positive regulation of lamellipodium assembly
GO:0010810	regulation of cell-substrate adhesion
GO:0030031	cell projection assembly
GO:0030036	actin cytoskeleton organization
GO:0042129	regulation of T cell proliferation
GO:0043131	erythrocyte enucleation
GO:0043304	regulation of mast cell degranulation
GO:0045453	bone resorption
GO:0045730	respiratory burst
GO:0060263	regulation of respiratory burst
GO:0060753	regulation of mast cell chemotaxis
GO:0070662	mast cell proliferation
GO:0070668	positive regulation of mast cell proliferation
GO:0071593	lymphocyte aggregation
GO:0090023	positive regulation of neutrophil chemotaxis
GO:1902622	regulation of neutrophil migration
GO:1903955	positive regulation of protein targeting to mitochondrion

	Cellular Component
GO:0005635	nuclear envelope
GO:0005737	cytoplasm
GO:0005741	mitochondrial outer membrane
GO:0005789	endoplasmic reticulum membrane
GO:0005829	cytosol
GO:0005884	actin filament
GO:0005886	plasma membrane
GO:0005925	focal adhesion
GO:0016020	membrane
GO:0030027	lamellipodium
GO:0030670	phagocytic vesicle membrane
GO:0043020	NADPH oxidase complex
GO:0070062	extracellular exosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2w2v, PDBe:2w2v, PDBj:2w2v
PDBsum	2w2v
PubMed	19394299
UniProt	P15153\|RAC2_HUMAN Ras-related C3 botulinum toxin substrate 2 (Gene Name=RAC2)

[Back to BioLiP]