Structure of PDB 2vzr Chain B

Receptor sequence

>2vzrB (length=126) Species: 31958 (Amycolatopsis orientalis)

DPVDYQAEDATIVQGAVESNHAGYTGTGFVNYDNVAGSSVEWTVTVPSAG
TYDVVVRYANGTTTSRPLDFSVNGSISASGVAFGSTGTWPAWTTKTVRVT
LAAGVNKIKAVATTANGGPNVDKITL

3D structure

• PDB: 2vzr Evidence that Family 35 Carbohydrate Binding Modules Display Conserved Specificity But Divergent Function.
• Chain: B
• Resolution: 1.95 Å

Enzymatic activity

• Enzyme Commision number: 3.2.1.165: exo-1,4-beta-D-glucosaminidase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CA	B	Q7 E9 T26 G29 D123	Q6 E8 T25 G28 D122
BS02	GCU	B	H22 N32 N35 R67 W90 N121	H21 N31 N34 R66 W89 N120	MOAD: Ka=19000M^-1
BS03	CA	B	N32 Y33 N35	N31 Y32 N34

Gene Ontology

Molecular Function

• GO:0030246 carbohydrate binding

External links

• PDB: RCSB:2vzr, PDBe:2vzr, PDBj:2vzr
• PDBsum: 2vzr
• PubMed: 19218457
• UniProt: Q56F26|EBDG_AMYOR Exo-beta-D-glucosaminidase (Gene Name=csxA)