Structure of PDB 2vyp Chain B

Receptor sequence

>2vypB (length=329) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]

TALVCDNGSGLVKAGFAGDDAPRAVFPPIEHGIITNWDDMEKIWHHTFYN
ELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSL
YASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKI
LTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAALEKSYELPDGQ
VITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYAN
NVMSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSIL
ASLSTFQQMWITKQEYDEAGPSIVHRKCF

3D structure

PDB

2vyp The Absolute Configuration of Rhizopodin and its Inhibition of Actin Polymerization by Dimerization.

Chain

Resolution

2.35 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

3.6.4.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	RH9	B	Y143 S145 G146 R147 Y169 I345 T351 M355	Y101 S103 G104 R105 Y127 I299 T305 M309
BS02	CA	B	Q354 W356 E361	Q308 W310 E315
BS03	ATP	B	G13 S14 L16 K18 G156 D157 G158 V159 G182 K213 E214 G301 G302 M305 Y306	G8 S9 L11 K13 G114 D115 G116 V117 G140 K171 E172 G255 G256 M259 Y260
BS04	CA	B	D286 D288	D240 D242

Gene Ontology

	Molecular Function
GO:0000287	magnesium ion binding
GO:0003785	actin monomer binding
GO:0005509	calcium ion binding
GO:0005515	protein binding
GO:0005523	tropomyosin binding
GO:0005524	ATP binding
GO:0016787	hydrolase activity
GO:0019904	protein domain specific binding
GO:0031013	troponin I binding
GO:0031432	titin binding
GO:0032036	myosin heavy chain binding
GO:0042802	identical protein binding
GO:0048306	calcium-dependent protein binding
GO:0140660	cytoskeletal motor activator activity

	Biological Process
GO:0010628	positive regulation of gene expression
GO:0030041	actin filament polymerization
GO:0030240	skeletal muscle thin filament assembly
GO:0048741	skeletal muscle fiber development
GO:0051017	actin filament bundle assembly
GO:0090131	mesenchyme migration

	Cellular Component
GO:0001725	stress fiber
GO:0005737	cytoplasm
GO:0005856	cytoskeleton
GO:0005865	striated muscle thin filament
GO:0005884	actin filament
GO:0030027	lamellipodium
GO:0030175	filopodium
GO:0031941	filamentous actin
GO:0032432	actin filament bundle
GO:0044297	cell body
GO:0098723	skeletal muscle myofibril

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2vyp, PDBe:2vyp, PDBj:2vyp
PDBsum	2vyp
PubMed	19035596
UniProt	P68135\|ACTS_RABIT Actin, alpha skeletal muscle (Gene Name=ACTA1)

[Back to BioLiP]