Structure of PDB 2vpy Chain B

Receptor sequence

>2vpyB (length=193) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]

MPRYAMAIDLSLCVGCAACAVACKMENEVPPGVFNLWIREREVGEYPNLV
VEFRPEQCLHCENPPCVPVCPTGASYQTKDGLVLVDPKKCIACGACIAAC
PYDARYLHPAGYVSKCTFCAHRLEKGKVPACVETCPTYCRTFGDLEDPES
PVAKALKAAERVDVLRPEQGTRPKLFYLNAPSKKGLTRESEVH

3D structure

PDB

2vpy Molecular Mechanism of Energy Conservation in Polysulfide Respiration.

Chain

Resolution

2.5 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	SF4	B	C13 C16 A18 C19 C135 T137 C139 R140	C13 C16 A18 C19 C135 T137 C139 R140
BS02	SF4	B	C23 N27 L36 C116 F118 C119 P129 C131	C23 N27 L36 C116 F118 C119 P129 C131
BS03	SF4	B	C58 L59 H60 C61 P64 C66 V83 C100 K115	C58 L59 H60 C61 P64 C66 V83 C100 K115
BS04	SF4	B	C70 P71 S75 C90 I91 A92 C93 G94 C96	C70 P71 S75 C90 I91 A92 C93 G94 C96

Gene Ontology

	Molecular Function
GO:0009055	electron transfer activity
GO:0046872	metal ion binding
GO:0051539	4 iron, 4 sulfur cluster binding

View graph for
Molecular Function

External links

PDB	RCSB:2vpy, PDBe:2vpy, PDBj:2vpy
PDBsum	2vpy
PubMed	18536726
UniProt	Q72LA5

[Back to BioLiP]