Structure of PDB 2vn2 Chain B |
>2vn2B (length=109) Species: 235909 (Geobacillus kaustophilus HTA426) [Search protein sequence] |
MEKKKVAEWLAQGSIAVPKLLLGHYKQLGLGEGELVLLLHMQSFFEEGVL FPTPAELAERMTVSAAECMEMVRRLLQKGMIAIEEKYTLEPLWEKLVHHL YTQAAQQGE |
|
PDB | 2vn2 Crystal Structure of the N-Terminal Domain of Geobacillus Kaustophilus Hta426 Dnad Protein. |
Chain | B |
Resolution | 2.3 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MG |
B |
H24 Q27 H109 Q113 |
H24 Q27 H99 Q103 |
|
|
|