Structure of PDB 2vmy Chain B

Receptor sequence

>2vmyB (length=405) Species: 1422 (Geobacillus stearothermophilus) [Search protein sequence]

MKYLPQQDPQVFAAIEQERKRQHAKIELIASENFVSRAVMEAQGSVLTNK
YAEGYPGRRYYGGCEYVDIVEELARERAKQLFGAEHANVQPHSGAQANMA
VYFTVLEHGDTVLGMNLSHGGHLTHGSPVNFSGVQYNFVAYGVDPETHVI
DYDDVREKARLHRPKLIVAAASAYPRIIDFAKFREIADEVGAYLMVDMAH
IAGLVAAGLHPNPVPYAHFVTTTTHKTLRGPRGGMILCQEQFAKQIDKAI
FPGIQGGPLMHVIAAKAVAFGEALQDDFKAYAKRVVDNAKRLASALQNEG
FTLVSGGTDNHLLLVDLRPQQLTGKTAEKVLDEVGITVNKNTIPYDPESP
GVTSGIRIGTAAVTTRGFGLEEMDEIAAIIGLVLKNVGSEQALEEARQRV
AALTD

3D structure

PDB

2vmy Structural and Functional Studies of Bacillus Stearothermophilus Serine Hydroxymethyltransferase: The Role of Asn(341), Tyr(60) and Phe(351) in Tetrahydrofolate Binding.

Chain

Resolution

2.7 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	Y51 E53 D197 T223 K226 R232
Catalytic site (residue number reindexed from 1)	Y51 E53 D197 T223 K226 R232
Enzyme Commision number	2.1.2.1: glycine hydroxymethyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	GLY	B	Y51 Y61	Y51 Y61
BS02	FFO	B	L117 G120 G121 H122 L123 V129 S172 N341 S349 P350 G351	L117 G120 G121 H122 L123 V129 S172 N341 S349 P350 G351
BS03	GLY	B	S31 H200 K226 R357	S31 H200 K226 R357
BS04	PLP	B	S93 G94 A95 H122 S172 D197 A199 K226	S93 G94 A95 H122 S172 D197 A199 K226
BS05	FFO	B	E53 Y60 F251	E53 Y60 F251

Gene Ontology

	Molecular Function
GO:0003824	catalytic activity
GO:0004372	glycine hydroxymethyltransferase activity
GO:0008270	zinc ion binding
GO:0016740	transferase activity
GO:0030170	pyridoxal phosphate binding
GO:0050897	cobalt ion binding
GO:0070905	serine binding

	Biological Process
GO:0006545	glycine biosynthetic process
GO:0006565	L-serine catabolic process
GO:0006730	one-carbon metabolic process
GO:0008652	amino acid biosynthetic process
GO:0019264	glycine biosynthetic process from serine
GO:0035999	tetrahydrofolate interconversion
GO:0046653	tetrahydrofolate metabolic process
GO:0046655	folic acid metabolic process

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2vmy, PDBe:2vmy, PDBj:2vmy
PDBsum	2vmy
PubMed	19046138
UniProt	Q7SIB6

[Back to BioLiP]