Structure of PDB 2vkr Chain B

Receptor sequence
>2vkrB (length=103) Species: 2283 (Acidianus ambivalens) [Search protein sequence]
GIDPNYRTSRQVVGEHQGHKVYGPVDPPKVLGIHGTIVGVDFDLCIADGS
CITACPVNVFQWYDTPGHPASEKKADPINEQACIFCMACVNVCPVAAIDV
KPP
3D structure
PDB2vkr Crystallographic analysis of the intact metal centres [3Fe-4S](1+/0) and [4Fe-4S](2+/1+) in a Zn(2+) -containing ferredoxin.
ChainB
Resolution2.01 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 F3S B C45 I46 A47 D48 G49 C51 A75 C93 P94 C45 I46 A47 D48 G49 C51 A75 C93 P94
BS02 SF4 B C55 P56 V59 C83 I84 F85 C86 M87 C89 C55 P56 V59 C83 I84 F85 C86 M87 C89
BS03 ZN B H16 H19 H34 D76 H16 H19 H34 D76
Gene Ontology
Molecular Function
GO:0008270 zinc ion binding
GO:0009055 electron transfer activity
GO:0016491 oxidoreductase activity
GO:0046872 metal ion binding
GO:0051536 iron-sulfur cluster binding
GO:0051538 3 iron, 4 sulfur cluster binding
GO:0051539 4 iron, 4 sulfur cluster binding

View graph for
Molecular Function
External links
PDB RCSB:2vkr, PDBe:2vkr, PDBj:2vkr
PDBsum2vkr
PubMed18258200
UniProtP49949|FER_ACIAM Zinc-containing ferredoxin (Gene Name=zfx)

[Back to BioLiP]