Structure of PDB 2vh9 Chain B

Receptor sequence

>2vh9B (length=266) Species: 4020 (Tropaeolum majus)

QGPPSPGYYPSSQITSLGFDQGYTNLWGPQHQRVDQGSLTIWLDSTSGSG
FKSINRYRSGYFGANIKLQSGYTAGVITSFYLSNNQDYPGKHDEIDIEFL
GTIPGKPYTLQTNVFIEGSGDREMRIHLWFDPTQDYHNYAIYWTPSEIIF
FVDDVPIRRYPRKSDATFPLRPLWVYGSVWDASSWATENGKYKADYRYQP
FVGKYEDFKLGSCTVEAASSCNPASVSPYGQLSQQQVAAMEWVQKNYMVY
NYCDDPTRDHTLTPEC

3D structure

• PDB: 2vh9 Analysis of Nasturtium Tmnxg1 Complexes by Crystallography and Molecular Dynamics Provides Detailed Insight Into Substrate Recognition by Family Gh16 Xyloglucan Endo-Transglycosylases and Endo-Hydrolases.
• Chain: B
• Resolution: 2.1 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): E94 D96 E98
• Catalytic site (residue number reindexed from 1): E94 D96 E98
• Enzyme Commision number: 2.4.1.207: xyloglucan:xyloglucosyl transferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	XYS	B	Y88 P89	Y88 P89
BS02	BGC	B	W27 Y81 S178 W180	W27 Y81 S178 W180
BS03	XYS	B	L26 N85	L26 N85
BS04	ZN	B	D259 T261	D259 T261
BS05	BGC	B	Y81 E94 E98 W180	Y81 E94 E98 W180

Gene Ontology

Molecular Function

• GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds
• GO:0016762 xyloglucan:xyloglucosyl transferase activity

Biological Process

• GO:0005975 carbohydrate metabolic process
• GO:0010411 xyloglucan metabolic process
• GO:0042546 cell wall biogenesis
• GO:0044042 glucan metabolic process

Cellular Component

• GO:0005618 cell wall
• GO:0048046 apoplast

External links

• PDB: RCSB:2vh9, PDBe:2vh9, PDBj:2vh9
• PDBsum: 2vh9
• PubMed: 19004021
• UniProt: Q07524