Structure of PDB 2va2 Chain B

Receptor sequence

>2va2B (length=343) Species: 273057 (Saccharolobus solfataricus P2)

HMIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYE
ARKFGVKAGIPIVEAKKILPNAVYLPMRKEVYQQVSSRIMNLLREYSEKI
EIASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKV
FAKIAADMAKPNGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGI
NKLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYNEPIRTRVRKSIGRIV
TMKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRG
RTFPHGISKETAYSESVKLLQKILEEDERKIRRIGVRFSKFIE

3D structure

• PDB: 2va2 Structure and Activity of Y-Class DNA Polymerase Dpo4 from Sulfolobus Solfataricus with Templates Containing the Hydrophobic Thymine Analog 2,4- Difluorotoluene.
• Chain: B
• Resolution: 2.8 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.7: DNA-directed DNA polymerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	B	S103 D105 E106 K152 G185 G187 I189 T190 S297 R298 T301 K339	S104 D106 E107 K153 G186 G188 I190 T191 S298 R299 T302 K340
BS02	dna	B	V32 F37 S40 G41 A42 P60 E219 R242 K243 S244 R247 I248 T250 K275 L293 R331 R332 R336	V33 F38 S41 G42 A43 P61 E220 R243 K244 S245 R248 I249 T251 K276 L294 R332 R333 R337
BS03	CA	B	D7 F8 D105	D8 F9 D106
BS04	CA	B	A181 I186	A182 I187
BS05	DCT	B	Y10 T45 Y48 R51	Y11 T46 Y49 R52

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0003677 DNA binding
• GO:0003684 damaged DNA binding
• GO:0003887 DNA-directed DNA polymerase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006260 DNA replication
• GO:0006261 DNA-templated DNA replication
• GO:0006281 DNA repair
• GO:0006974 DNA damage response
• GO:0042276 error-prone translesion synthesis

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:2va2, PDBe:2va2, PDBj:2va2
• PDBsum: 2va2
• PubMed: 17951245
• UniProt: Q97W02|DPO4_SACS2 DNA polymerase IV (Gene Name=dbh)