Structure of PDB 2v9w Chain B

Receptor sequence

>2v9wB (length=342) Species: 273057 (Saccharolobus solfataricus P2)

MIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYEA
RKFGVKAGIPIVEAKKILPNAVYLPMRKEVYQQVSSRIMNLLREYSEKIE
IASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKVF
AKIAADMAKPNGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGIN
KLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYNEPIRTRVRKSIGRIVT
MKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGR
TFPHGISKETAYSESVKLLQKILEEDERKIRRIGVRFSKFIE

3D structure

• PDB: 2v9w Structure and Activity of Y-Class DNA Polymerase Dpo4 from Sulfolobus Solfataricus with Templates Containing the Hydrophobic Thymine Analog 2,4-Difluorotoluene.
• Chain: B
• Resolution: 3.0 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.7: DNA-directed DNA polymerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	B	S103 D105 G185 G187 I189 T190 V296 S297 R298 G299 T301 K339	S103 D105 G185 G187 I189 T190 V296 S297 R298 G299 T301 K339
BS02	dna	B	F37 S40 G41 A42 G58 P60 E63 E219 A220 K243 S244 I245 R247 I248 V249 T250 R331 R332 R336	F37 S40 G41 A42 G58 P60 E63 E219 A220 K243 S244 I245 R247 I248 V249 T250 R331 R332 R336
BS03	CA	B	D7 F8 D105	D7 F8 D105
BS04	CA	B	D105 E106	D105 E106
BS05	DCT	B	D7 Y10 Y12 A44 A57 D105	D7 Y10 Y12 A44 A57 D105

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0003677 DNA binding
• GO:0003684 damaged DNA binding
• GO:0003887 DNA-directed DNA polymerase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006260 DNA replication
• GO:0006261 DNA-templated DNA replication
• GO:0006281 DNA repair
• GO:0006974 DNA damage response
• GO:0042276 error-prone translesion synthesis

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:2v9w, PDBe:2v9w, PDBj:2v9w
• PDBsum: 2v9w
• PubMed: 17951245
• UniProt: Q97W02|DPO4_SACS2 DNA polymerase IV (Gene Name=dbh)