Structure of PDB 2v83 Chain B

Receptor sequence
>2v83B (length=79) Species: 10090 (Mus musculus) [Search protein sequence]
GSPEFGYWITCCPTCDVDINTWVPFYSTELNKPAMIYCSHGDGHWVHAQC
MDLEERTLIHLSEGSNKYYCNEHVQIARA
3D structure
PDB2v83 The Plant Homeodomain Finger of Rag2 Recognizes Histone H3 Methylated at Both Lysine-4 and Arginine-2.
ChainB
Resolution2.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide B G449 D450 G41 D42
BS02 peptide B Y415 S435 T436 E437 L438 K440 A442 M443 I444 W453 L469 S470 N474 Y7 S27 T28 E29 L30 K32 A34 M35 I36 W45 L61 S62 N66
BS03 ZN B C419 C423 H455 C458 C11 C15 H47 C50
BS04 ZN B C446 H452 C478 H481 C38 H44 C70 H73
Gene Ontology
Biological Process
GO:0006310 DNA recombination
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2v83, PDBe:2v83, PDBj:2v83
PDBsum2v83
PubMed18025461
UniProtP21784|RAG2_MOUSE V(D)J recombination-activating protein 2 (Gene Name=Rag2)

[Back to BioLiP]