Structure of PDB 2v3c Chain B

Receptor sequence
>2v3cB (length=87) Species: 2190 (Methanocaldococcus jannaschii) [Search protein sequence]
MIIWPSYIDKKKSRREGRKVPEELAIEKPSLKDIEKALKKLGLEPKIYRD
KRYPRQHWEICGCVEVDYKGNKLQLLKEICKIIKGKN
3D structure
PDB2v3c Interaction of Signal-Recognition Particle 54 Gtpase Domain and Signal-Recognition Particle RNA in the Free Signal-Recognition Particle.
ChainB
Resolution2.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna B M1 Y7 S13 R14 R18 K19 P21 E22 K51 R52 P54 R55 H57 D67 Y68 K69 K72 M1 Y7 S13 R14 R18 K19 P21 E22 K51 R52 P54 R55 H57 D67 Y68 K69 K72
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0008312 7S RNA binding
Biological Process
GO:0006612 protein targeting to membrane
GO:0006614 SRP-dependent cotranslational protein targeting to membrane
Cellular Component
GO:0005737 cytoplasm
GO:0048500 signal recognition particle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2v3c, PDBe:2v3c, PDBj:2v3c
PDBsum2v3c
PubMed17846429
UniProtQ58440|SRP19_METJA Signal recognition particle 19 kDa protein (Gene Name=srp19)

[Back to BioLiP]