Structure of PDB 2uuf Chain B

Receptor sequence

>2uufB (length=252) Species: 9606 (Homo sapiens)

IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPW
DKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDI
ALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKETGQP
SVLQVVNLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDACEGDSGG
PFVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVIDQF
GE

3D structure

• PDB: 2uuf The Determination of Protonation States in Proteins.
• Chain: B
• Resolution: 1.26 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H57 D102 E192 G193 D194 S195 G196
• Catalytic site (residue number reindexed from 1): H43 D99 E195 G196 D197 S198 G199
• Enzyme Commision number: 3.4.21.5: thrombin.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	B	E23 I24 G25 M26 P28 W29 H119 P120 C122 Y134 K135 R137 N159 M201 K202 N205 R206 W207	E8 I9 G10 M11 P13 W14 H116 P117 C119 Y134 K135 R137 N157 M204 K205 N210 R211 W212
BS02	peptide	B	F34 L40 L65 R73 T74 Y76 K81 I82	F19 L26 L60 R68 T69 Y71 K77 I78
BS03	CA	B	K169 T172	K167 T170

Gene Ontology

Molecular Function

• GO:0004252 serine-type endopeptidase activity
• GO:0005509 calcium ion binding

Biological Process

• GO:0006508 proteolysis
• GO:0007596 blood coagulation

External links

• PDB: RCSB:2uuf, PDBe:2uuf, PDBj:2uuf
• PDBsum: 2uuf
• PubMed: 17642517
• UniProt: P00734|THRB_HUMAN Prothrombin (Gene Name=F2)