Structure of PDB 2sod Chain B

Receptor sequence

>2sodB (length=151) Species: 9913 (Bos taurus) [Search protein sequence]

ATKAVCVLKGDGPVQGTIHFEAKGDTVVVTGSITGLTEGDHGFHVHQFGD
NTQGCTSAGPHFNPLSKKHGGPKDEERHVGDLGNVTADKNGVAIVDIVDP
LISLSGEYSIIGRTMVVHEKPDDLGRGGNEESTKTGNAGSRLACGVIGIA
K

3D structure

PDB

2sod Determination and analysis of the 2 A-structure of copper, zinc superoxide dismutase.

Chain

Resolution

2.0 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	H44 H46 H61 H69 H78 D81 H118 R141
Catalytic site (residue number reindexed from 1)	H44 H46 H61 H69 H78 D81 H118 R141
Enzyme Commision number	1.15.1.1: superoxide dismutase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CU	B	H44 H46 H61 H118	H44 H46 H61 H118
BS02	ZN	B	H61 H69 H78 D81	H61 H69 H78 D81

Gene Ontology

	Molecular Function
GO:0004784	superoxide dismutase activity
GO:0004842	ubiquitin-protein transferase activity
GO:0005507	copper ion binding
GO:0005515	protein binding
GO:0008270	zinc ion binding
GO:0016209	antioxidant activity
GO:0016491	oxidoreductase activity
GO:0030346	protein phosphatase 2B binding
GO:0042803	protein homodimerization activity
GO:0046872	metal ion binding
GO:0051087	protein-folding chaperone binding

	Biological Process
GO:0000209	protein polyubiquitination
GO:0000303	response to superoxide
GO:0001541	ovarian follicle development
GO:0001819	positive regulation of cytokine production
GO:0001895	retina homeostasis
GO:0002262	myeloid cell homeostasis
GO:0006749	glutathione metabolic process
GO:0006801	superoxide metabolic process
GO:0006879	intracellular iron ion homeostasis
GO:0007283	spermatogenesis
GO:0007566	embryo implantation
GO:0007605	sensory perception of sound
GO:0007626	locomotory behavior
GO:0008217	regulation of blood pressure
GO:0009408	response to heat
GO:0019226	transmission of nerve impulse
GO:0019430	removal of superoxide radicals
GO:0032287	peripheral nervous system myelin maintenance
GO:0040014	regulation of multicellular organism growth
GO:0042542	response to hydrogen peroxide
GO:0043085	positive regulation of catalytic activity
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0043410	positive regulation of MAPK cascade
GO:0043524	negative regulation of neuron apoptotic process
GO:0045471	response to ethanol
GO:0046716	muscle cell cellular homeostasis
GO:0048678	response to axon injury
GO:0050665	hydrogen peroxide biosynthetic process
GO:0051881	regulation of mitochondrial membrane potential
GO:0060047	heart contraction
GO:0060052	neurofilament cytoskeleton organization
GO:0060087	relaxation of vascular associated smooth muscle
GO:0060088	auditory receptor cell stereocilium organization
GO:0072593	reactive oxygen species metabolic process

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005739	mitochondrion
GO:0005777	peroxisome
GO:0005829	cytosol
GO:0005886	plasma membrane
GO:0031410	cytoplasmic vesicle
GO:0032839	dendrite cytoplasm
GO:0032991	protein-containing complex
GO:0043025	neuronal cell body

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2sod, PDBe:2sod, PDBj:2sod
PDBsum	2sod
PubMed	7175933
UniProt	P00442\|SODC_BOVIN Superoxide dismutase [Cu-Zn] (Gene Name=SOD1)

[Back to BioLiP]